PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G012900.1
Common NamePHAVU_005G012900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 512aa    MW: 56693.4 Da    PI: 4.7509
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G012900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-183582148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+ Ed +lvd+v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Phvul.005G012900.1 35 KGPWTAAEDVILVDYVNKHGEGNWNAVQKYSGLSRCGKSCRLRWANHL 82
                        79******************************************9986 PP

2Myb_DNA-binding51.22.9e-1688131146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE++ ++++++++G++ W++ a++++ gRt++++k++w++
  Phvul.005G012900.1  88 KGAFTAEEEQMIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 131
                         799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8743082IPR017930Myb domain
SuperFamilySSF466891.42E-3034129IPR009057Homeodomain-like
SMARTSM007173.1E-153484IPR001005SANT/Myb domain
PfamPF002491.1E-153582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-233689IPR009057Homeodomain-like
CDDcd001672.19E-113782No hitNo description
PROSITE profilePS5129424.88983137IPR017930Myb domain
SMARTSM007172.8E-1687135IPR001005SANT/Myb domain
PfamPF002492.7E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2690136IPR009057Homeodomain-like
CDDcd001671.23E-1190131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MSQITHDIDD NVHGEDQTGS QLNDEGNGGG VVLKKGPWTA AEDVILVDYV NKHGEGNWNA  60
VQKYSGLSRC GKSCRLRWAN HLRPNLKKGA FTAEEEQMIA ELHAKMGNKW ARMAAHLPGR  120
TDNEIKNYWN TRMKRRQRAG LPLYPPEIVM QAFQDSKHGQ GTGEINDGDG CHHDFMEKNN  180
YEMHDAIFDS LKENQGILPF VPELSDISAN SILPNVLGSP PYCNFLPSTL PNQDHLQETS  240
VSFIGSNELN TNGFYPFNHF KDNTSGKIAE SFGLHSPLDH GASSYGSICY SHSLSNDNYS  300
TSKPTSEAVK SELPSLQYPE TEFVSWGSSP PPPLNESIDV LIHSPQPPYA LDSGSSPLSC  360
CFLNEFLYQQ AKALNYSKNN WSDKSSSSSI ATPVDRAESS ALNMYETEWE DYADPVSPFG  420
ATSILNEHPV VGTNGKSWDG WEPFQTFSGN NEKLQSVDQV LAPKSENQSM SLLNLTWPDV  480
LLASDWHELY SEHDGMNHAG MIDASDDVKR Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-29321361104C-Myb DNA-Binding Domain
1msf_C2e-29321361104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148771.10.0hypothetical protein PHAVU_005G012900g
TrEMBLV7BUN60.0V7BUN6_PHAVU; Uncharacterized protein
STRINGGLYMA04G15150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-102myb domain protein 33